PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g057770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 311aa    MW: 34692.8 Da    PI: 7.3945
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g057770.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-18162216256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Csa08g057770.1 162 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 216
                     778899***********************************************98 PP

2HD-ZIP_I/II128.62.6e-41162251191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk+q+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Csa08g057770.1 162 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELR-TL 251
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-17141216IPR009057Homeodomain-like
SuperFamilySSF466893.59E-18154219IPR009057Homeodomain-like
PROSITE profilePS5007116.989158218IPR001356Homeobox domain
SMARTSM003891.5E-16160222IPR001356Homeobox domain
CDDcd000861.64E-15162219No hitNo description
PfamPF000462.0E-15162216IPR001356Homeobox domain
PROSITE patternPS000270193216IPR017970Homeobox, conserved site
PfamPF021836.3E-11218251IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.2E-26218261IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MELALSLGDN TKKQFPFLEK HSKINNPSAS STSTSDKDLG FCMGLDVAFA GHRSLSSSSS  60
PSVEDLQLHF PNWLPENGRQ EGRILSGVAT VVAEEEDEVE EAVPSMSVSP PNSVTSSFQL  120
DFGIKSYGYE RRNNKRDIDD EVERSASRAS NEDNDDENGS TRKKLRLSKD QSAFLEDSFK  180
EHSTLNPKQK IALAKQLNLR PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CESLTEENRR  240
LQKEVKELRT LKTSTPFYMQ LPATTLTMCP SCERVATSAT QPATSVSQNL GLATSPLHCP  300
VKPRSAKQVS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160166TRKKLRL
2210218RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4311820.0AJ431182.2 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT14 (hat14 gene).
GenBankAK2274230.0AK227423.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL14-07-H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010423311.10.0PREDICTED: homeobox-leucine zipper protein HAT14-like
SwissprotP466650.0HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLR0FFM30.0R0FFM3_9BRAS; Uncharacterized protein
STRINGAT5G06710.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-171homeobox from Arabidopsis thaliana